PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.HXE97
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 498aa    MW: 56067.9 Da    PI: 6.4546
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.HXE97genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.22.1e-145194146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g W++eEd ll +a k++G++ W+ Ia+ +  gRt++ +k+r+ +
      Aradu.HXE97 51 KGGWSPEEDMLLCEAQKLYGNR-WTEIAKVVS-GRTDNAVKNRFST 94
                     688*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-41141IPR009057Homeodomain-like
PROSITE profilePS500905.0882141IPR017877Myb-like domain
SuperFamilySSF466896.56E-1939104IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.2E-204299IPR009057Homeodomain-like
PROSITE profilePS5129421.00246100IPR017930Myb domain
SMARTSM007174.0E-155098IPR001005SANT/Myb domain
PfamPF002496.3E-135194IPR001005SANT/Myb domain
CDDcd001671.08E-105495No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MKKQEEQCNR ESKKKGHIVT WTQEEDDILR EQIGIHGTEK WYTYLNSDFK KGGWSPEEDM  60
LLCEAQKLYG NRWTEIAKVV SGRTDNAVKN RFSTLCRKRQ KYEALAKENS ISSHINSNNK  120
KIVFQHAYNT DATSESAISI KKMRRAHITD DGGKIKFGDR SHLRNGTLIN QHPRTPFAVL  180
AQNSQNINNL LDELQICNAK FSSSAQNNKT QGTFLKRDDP KIDALMQQAE LLSSLAQNID  240
TEDMDQSLEN TWKVNLHNLL ACIVLILSIE HNICNLSSHE DGKRHESLKE VDLAFKKSEV  300
LQEFLNRTKE ANNLKCKIQG LKLADLKNMV EDLSSNEGGQ PCWRQMDLYE DSPASSEYST  360
GSTILPLSAG DIMEHSSHRD IKTEMKTTQI EDKKEVDGCE RGVLVTATLD QDMLPNSEEQ  420
INNDSTVSAS SRVEFGSPVQ VTPIFRSLAA GIPSPQFSES ERNFLRKTLG VESPSLNPSA  480
QPSQPPPCKR ALLDSLQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-16219810107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015956954.10.0PREDICTED: myb-related protein A isoform X3
TrEMBLA0A0B2PGQ10.0A0A0B2PGQ1_GLYSO; Myb-related protein B
STRINGGLYMA08G40950.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF34803461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02820.21e-135myb domain protein 88